PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_015278
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 216aa    MW: 23437.6 Da    PI: 4.7628
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_015278genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.97.4e-43541531100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++kll++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q++ l+aela+++
  DCAR_015278  54 PCAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHRVFGASNIIKLLQELPESQRADAVSSMVYEANARVRDPVYGCAGAICHLQKQVSDLQAELAKAQ 151
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  DCAR_015278 152 AE 153
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.18153154IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-4254151IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MEGTSASNIS VTKPLLYSTN SLPSQTFSNN SPSGLSSDTT SGTPVPPTAA VMSPCAACKI  60
LRRRCVEKCV LAPYFPPTDP LKFTIAHRVF GASNIIKLLQ ELPESQRADA VSSMVYEANA  120
RVRDPVYGCA GAICHLQKQV SDLQAELAKA QAEIVNMQCQ QANLLTLICM DMSAQPHNQD  180
QESMITDNNQ QPYENLNFFP DLDVNLSSVL EPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004307415.14e-85PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR04e-76LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A124SHJ64e-87A0A124SHJ6_CYNCS; Lateral organ boundaries domain-containing protein
STRINGGLYMA13G40370.22e-84(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-77LOB domain-containing protein 1